The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of uncharacterized protein MJ1198 from Methanocaldococcus jannaschii. Northeast Structural Genomics Target MjR117B. To be Published
    Site NESGC
    PDB Id 2k52 Target Id MjR117B
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8975,15821,, PF00575 Molecular Weight 8288.18 Da.
    Residues 71 Isoelectric Point 6.47
    Sequence dvepgkfykgvvtriekygafinlneqvrgllrprdmislrlenlnvgdeiivqaidvrpekreidfky ip
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2k52

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch