.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k50

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of the replication Factor A Related Protein from Methanobacterium thermoautotrophicum. Northeast Structural Genomics Target TR91A. To be Published
    Site NESGC
    PDB Id 2k50 Target Id TR91A
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9191,PF01336, 2.40.50.140, 15819 Molecular Weight 11944.19 Da.
    Residues 106 Isoelectric Point 9.81
    Sequence kpehrmdtiskleegaetpvtgrvmkissprtfttrkgregklanviiaddtgelravfwtenikllkk fregdvirikdvnirggfggrkeahlmprstvevldp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k50
    1. Cellular prion protein conformation and function
    FF Damberger, B Christen, DR Prez - Proceedings of the , 2011 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch