.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k4v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of uncharacterized protein PA1076 from Pseudomonas aeruginosa. To be Published
    Site NESGC
    PDB Id 2k4v Target Id PaT3
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS9006,15810 Molecular Weight 13742.65 Da.
    Residues 120 Isoelectric Point 5.61
    Sequence mfepghlhlvslpgldqqdinihiryevrqnaesgayvhfdmdgeidgkpfsdsfelprdtafnfasda trvaqkhglhpkfgaitrvhkeydamfediraklhahpgepvdleriirhe
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k4v
    1. Assessment of CASP8 structure predictions for template free targets
    M Ben_David, O Noivirt_Brik, A Paz - Proteins: Structure, , 2009 - Wiley Online Library
     
    2. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    3. Modeling Disordered Regions in Proteins Using Rosetta
    RYR Wang, Y Han, K Krassovsky, W Sheffler, M Tyka - PloS one, 2011 - dx.plos.org
     
    4. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    5. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch