.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k4m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of M. thermoautotrophicum protein MTH_1000, Northeast Structural Genomics Consortium Target TR8. To be Published
    Site NESGC
    PDB Id 2k4m Target Id TR8
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9189,PF03686 Molecular Weight 15088.72 Da.
    Residues 133 Isoelectric Point 9.44
    Sequence mwndlavyiircsgpgtrvvevgagrflyvsdyirkhskvdlvltdikpshggivrdditsprmeiyrg aaliysirppaeihsslmrvadavgarliikpltgedivterkmklvnygrtyfyeyiaevrsr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k4m

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch