.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k1g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the NlpC/P60 domain of lipoprotein Spr from Escherichia coli: structural evidence for a novel cysteine peptidase catalytic triad. Biochemistry 47 9715-9717 2008
    Site NESGC
    PDB Id 2k1g Target Id ER541
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8856,PF00877, 1560, 2.30.30.330, 3.90.1720.10, 2.30.260.10 Molecular Weight 18291.54 Da.
    Residues 162 Isoelectric Point 9.88
    Sequence msanntaknmhpetravgsetsslqasqdefenlvrnvdvksrimdqyadwkgvryrlggstkkgidcs gfvqrtfreqfglelprstyeqqemgksvsrsnlrtgdlvlfragstgrhvgiyignnqfvhastssgv iissmnepywkkrynearrvlsrs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k1g
    1. Structural Basis of Murein Peptide Specificity of a [gamma]-D-Glutamyl-L-Diamino Acid Endopeptidase
    Q Xu, S Sudek, D McMullan, MD Miller, B Geierstanger - Structure, 2009 - Elsevier
     
    2. Solution NMR Structure of the NlpC/P60 Domain of Lipoprotein Spr from Escherichia coli: Structural Evidence for a Novel Cysteine Peptidase Catalytic Triad
    JM Aramini, P Rossi, YJ Huang, L Zhao, M Jiang - Biochemistry, 2008 - ACS Publications
     
    3. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     
    4. Solution structure of the N-terminal catalytic domain of human H-REV107-A novel circular permutated NlpC/P60 domain
    X Ren, J Lin, C Jin, B Xia - FEBS letters, 2010 - Elsevier
     
    5. Peptidoglycan remodeling in Mycobacterium tuberculosis-comparison of structures and catalytic activities of RipA and RipB
    D Bth, G Schneider, R Schnell - Journal of Molecular Biology, 2011 - Elsevier
     
    6. Structural elucidation of the Cys_His_Glu_Asn proteolytic relay in the secreted CHAP domain enzyme from the human pathogen Staphylococcus saprophyticus
    P Rossi, JM Aramini, R Xiao, CX Chen - Proteins: Structure, , 2009 - Wiley Online Library
     
    7. Structural insights into the effectorimmunity system Tse1/Tsi1 from Pseudomonas aeruginosa
    J Benz, C Sendlmeier, TRM Barends, A Meinhart - PloS one, 2012 - dx.plos.org
     
    8. Crystal structure of type VI effector Tse1 from Pseudomonas aeruginosa
    H Zhang, ZQ Gao, XD Su, YH Dong - FEBS letters, 2012 - Elsevier
     
    9. Structural insights into the Pseudomonas aeruginosa type VI virulence effector Tse1 bacteriolysis and self-protection mechanisms
    J Ding, W Wang, H Feng, Y Zhang, DC Wang - Journal of Biological , 2012 - ASBMB
     
    10. Structure of a peptidoglycan amidase effector targeted to Gram-negative bacteria by the type VI secretion system
    S Chou, NK Bui, AB Russell, KW Lexa, TE Gardiner - Cell Reports, 2012 - Elsevier
     
    11. Structural insight into functioning of Pseudomonas aeruginosa peptidoglycan-hydolase Tse1 and its immunity protein Tsi1
    S Guijun, L Xiuhua, L Defen, Z Junbing, L Ning - Biochemical , 2012 - biochemj.org
     
    12. The Role of Bacteriophage Lambda gpK in Tail Assembly and Host Cell Entry
    DL Coburn - 2011 - tspace.library.utoronto.ca
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch