.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jyx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162. To be Published
    Site NESGC
    PDB Id 2jyx Target Id ER541
    Related PDB Ids 2k1g 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8855,PF00877, 1560 Molecular Weight 18291.54 Da.
    Residues 162 Isoelectric Point 9.88
    Sequence msanntaknmhpetravgsetsslqasqdefenlvrnvdvksrimdqyadwkgvryrlggstkkgidcsg fvqrtfreqfglelprstyeqqemgksvsrsnlrtgdlvlfragstgrhvgiyignnqfvhastssgvi issmnepywkkrynearrvlsrs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jyx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch