.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jy9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of putative tRNA hydrolase domain from Salmonella typhimurium. To be Published
    Site NESGC
    PDB Id 2jy9 Target Id StR220
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9169,15584, BIG_675, PF00472, 3.30.160.200 Molecular Weight 15594.04 Da.
    Residues 140 Isoelectric Point 10.92
    Sequence miaisrtvsiadneleitairaqgaggqhvnktssaihlrfdirasglpeyykqrlltashhlisddgv iiikaqefrsqelnreaaiarlvavikeltaeqksrratrptraskerrlsskaqkssvkalrgkvrrp ld
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jy9
    1. Escherichia coli YaeJ protein mediates a novel ribosome_rescue pathway distinct from SsrA_and ArfA_mediated pathways
    Y Chadani, K Ono, K Kutsukake - Molecular microbiology, 2011 - Wiley Online Library
     
    2. Structural basis for the rescue of stalled ribosomes: structure of YaeJ bound to the ribosome
    MG Gagnon, SV Seetharaman, D Bulkley, TA Steitz - Science, 2012 - sciencemag.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch