.
The Open Protein Structure Annotation Network
PDB Keyword
.

2juz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of HI0947 from Haemophilus influenzae. To be Published
    Site NESGC
    PDB Id 2juz Target Id IR123
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS8933,1.10.3390.10, PF07208, 15462 Molecular Weight 7683.41 Da.
    Residues 72 Isoelectric Point 6.70
    Sequence maqhskysdaqlsaivndmiavlekhkapvdlslialgnmasnllttsvpqtqcealaqafsnslinav ktr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2juz
    1. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch