.
The Open Protein Structure Annotation Network
PDB Keyword
.

2js7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Human Myeloid Differentiation Primary Response (MyD88). To be Published
    Site NESGC
    PDB Id 2js7 Target Id HR2869A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8913,PF01582, 3.40.50.10140, 15356 Molecular Weight 17907.01 Da.
    Residues 154 Isoelectric Point 8.41
    Sequence mgittlddplghmperfdaficycpsdiqfvqemirqleqtnyrlklcvsdrdvlpgtcvwsiaselie krcrrmvvvvsddylqskecdfqtkfalslspgahqkrlipikykamkkefpsilrfitvcdytnpctk swfwtrlakalslple
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2js7
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Structural analysis of cysteine S-nitrosylation: a modified acid-based motif and the emerging role of trans-nitrosylation
    SM Marino, VN Gladyshev - Journal of molecular biology, 2010 - Elsevier
     
    3. Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling
    H Ohnishi, H Tochio, Z Kato, KE Orii - Proceedings of the , 2009 - National Acad Sciences
     
    4. Prokaryotic homologs of Argonaute proteins are predicted to function as key components of a novel system of defense against mobile genetic elements
    KS Makarova, YI Wolf, J Van Der Oost, EV Koonin - Biol Direct, 2009 - biomedcentral.com
     
    5. Molecular mimicry in innate immunity
    SL Chan, LY Low, S Hsu, S Li, T Liu, E Santelli - Journal of Biological , 2009 - ASBMB
     
    6. 4D prediction of protein 1 H chemical shifts
    J Lehtivarjo, T Hassinen, SP Korhonen - Journal of biomolecular , 2009 - Springer
     
    7. MyD88 adaptor-like D96N is a naturally occurring loss-of-function variant of TIRAP
    J George, AV Kubarenko, A Rautanen - The Journal of , 2010 - Am Assoc Immnol
     
    8. Subversion of innate immune signaling through molecular mimicry
    TS Xiao - Journal of clinical immunology, 2010 - Springer
     
    9. In-silico characterization of the effects of phosphorylated tyrosines 86 and 106 on structure and binding of MAL: insight into hyperinflammatory response to infection by
    UHK Niazi, J Bibby, MJ Sutcliffe - Journal of Receptors and , 2011 - informahealthcare.com
     
    10. MYD88 somatic mutations in MALT lymphomas
    ZM Li, A Rinaldi, A Cavalli, AA Mensah - British Journal of , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch