.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jro

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of SO0334 from Shewanella oneidensis. To be Published
    Site NESGC
    PDB Id 2jro Target Id SoR75
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS9153,3.30.1910.10, 15337, PF06526 Molecular Weight 8138.37 Da.
    Residues 70 Isoelectric Point 10.28
    Sequence mrvfpvyapklivkharifltgviwvkdlgrlefekgrfllprkslpkvkqailelnelieaqnhqtkta
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jro

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch