.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jrn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Staphylococcus saprophyticus CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain protein. To be Published
    Site NESGC
    PDB Id 2jrn Target Id SyR11
    Related PDB Ids 2k3a 
    Molecular Characteristics
    Source Staphylococcus saprophyticus (atcc 15305)
    Alias Ids TPS9182,PF05257, 15335 Molecular Weight 15915.19 Da.
    Residues 155 Isoelectric Point 4.47
    Sequence mkklvtattltagigaaivgldhgneadaaeqtqptnqsttqstsgssanlytagqctwyvydkvggnig stwgnannwasaassagytvnnspeagsilqstaggyghvayvenvnsdgsvevsemnynggpfsvser tisageassynyihln
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jrn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch