.
The Open Protein Structure Annotation Network
PDB Keyword
.

2jov

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of Clostridium perfringens protein CPE0013. To be Published
    Site NESGC
    PDB Id 2jov Target Id CpR31
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS8799,3.10.530.10, 15203, PF07892 Molecular Weight 8593.70 Da.
    Residues 77 Isoelectric Point 9.89
    Sequence mhkdiftsvvrvrgskkynvvpvksnkpveiskwidfsnvlsrlyvgvptksgnvvcknimntgvdiic tknlpkds
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2jov

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch