The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of protein Uncharacterized BCR, Northeast Structural Genomics Consortium target CgR1. To be Published
    Site NESGC
    PDB Id 2jny Target Id CgR1
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS8794,PF03966,, 15133 Molecular Weight 6736.33 Da.
    Residues 59 Isoelectric Point 4.22
    Sequence msldpqllevlacpkdkgplryleseqllvnerlnlayriddgipvllideatewtpnn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2jny

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch