.
The Open Protein Structure Annotation Network
PDB Keyword
.

2imj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the hypothetical protein (DUF1348) from Pseudomonas fluorescens, Northeast Structural Genomics target PlR14. TO BE PUBLISHED
    Site NESGC
    PDB Id 2imj Target Id PlR14
    Molecular Characteristics
    Source Pseudomonas fluorescens
    Alias Ids TPS9027,3.10.450.50, PF07080 Molecular Weight 18985.24 Da.
    Residues 159 Isoelectric Point 6.44
    Sequence mssnaqvrpplppftresaiekirlaedgwnsrdpervslaytldtqwrnraefahnreeakafltrkw akeldyrlikelwaftdnriavryayewhddsgnwfrsygnenwefdeqglmarrfacindmpikaqer kfhwplgrrpddhpglselgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.50 Rfree 0.193
    Matthews' coefficent 2.08 Rfactor 0.169
    Waters 905 Solvent Content 40.84

    Ligand Information
    Ligands ACT (ACETATE) x 6;EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2imj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch