.
The Open Protein Structure Annotation Network
PDB Keyword
.

2im8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of hypothetical protein yPPE. Northeast Structural Genomics Consortium target SR213. To be Published
    Site NESGC
    PDB Id 2im8 Target Id SR213
    Related PDB Ids 2hfi 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9074,16113, PF08807, 1.20.120.440 Molecular Weight 14458.64 Da.
    Residues 123 Isoelectric Point 5.52
    Sequence mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegalelikvrrpky vhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiaredsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.257
    Matthews' coefficent 1.92 Rfactor 0.236
    Waters 165 Solvent Content 36.06

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2im8
    1. Crystal structures of MW1337R and lin2004: Representatives of a novel protein family that adopt a four_helical bundle fold
    P Kozbial, Q Xu, HJ Chiu, D McMullan - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch