.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i2l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein yopX from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 2i2l Target Id SR411
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9092,2.30.30.100, 2.30.30.290, PF09643 Molecular Weight 15193.31 Da.
    Residues 134 Isoelectric Point 4.48
    Sequence mntayrvwdgeqmhywddeglsliiksngdwtlkrlytdvlvpvvdstnrnaalmwgakvrgkfiydrs ivkitsddkessdvcevkfsdgvfqvdvskisadydvtavgwveyatievigdvyqnpellegvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.80 Rfree 0.286
    Matthews' coefficent 2.54 Rfactor 0.241
    Waters 134 Solvent Content 51.51

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i2l

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch