.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hrx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three dimensional structure of conserved hypothetical protein from Corynebacterium diphtheriae at the resolution 1.9 A. Northeast Structural Genomics Consortium target CdR13. TO BE PUBLISHED
    Site NESGC
    PDB Id 2hrx Target Id CdR13
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS8793,PF02622, 3.40.1740.10 Molecular Weight 21371.27 Da.
    Residues 198 Isoelectric Point 4.48
    Sequence mfadrlfnamernepapgmvlvaapsmesedfarsviliiehseyatfgvnlasrsdvavfnvipewvp cvtkpqalyiggplnqqsvvgvgvtaqgvdaarvdnltrlanrlvmvnlgadpeeikplvsgmrlfagh aewapgqlaqeiengdwfvapalpsdvtapgsvdvwgdvmrrqpmplplystfpvnvgen
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.222
    Matthews' coefficent 2.13 Rfactor 0.193
    Waters 154 Solvent Content 42.26

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hrx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch