The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the ydfO protein from Escherichia coli. Northeast Structural Genomics target ER251. To be Published
    Site NESGC
    PDB Id 2hh8 Target Id ER251
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8838,PF07166, 3.30.1810.10, 7274 Molecular Weight 18121.95 Da.
    Residues 150 Isoelectric Point 9.54
    Sequence mqttrpritwkvlpmaqvaifkeifdqvrkdlncelfyselkrhnvshyiyylatdnihivlendntvl ikglkkvvnvkfsrnthlietsydrlksreitfqqyrenlakagvfrwitnihehkryyytfdnsllft esiqnttqifpr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2hh8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch