The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of hypothetical protein yppE: Northeast Structural Genomics Consortium Target SR213. TO BE PUBLISHED
    Site NESGC
    PDB Id 2hfi Target Id SR213
    Related PDB Ids 2im8 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9075,16113, PF08807, Molecular Weight 14458.64 Da.
    Residues 123 Isoelectric Point 5.52
    Sequence mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegalelikvrrpky vhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiaredsr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2hfi

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch