The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of Bacillus subtilis protein YorP, Northeast Structural Genomics Target SR399. To be Published
    Site NESGC
    PDB Id 2heq Target Id SR399
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9091,PF09629,, 7175 Molecular Weight 8022.66 Da.
    Residues 71 Isoelectric Point 6.49
    Sequence mpkywsypvglaveinnnarygcphhvgrkgkiiehlhsatydyavsdetgdityfkeheltplkggla yv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2heq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch