.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h5m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins. J.Struct.Funct.Genom. 9 7-20 2008
    Site NESGC
    PDB Id 2h5m Target Id ZR31
    Related PDB Ids 1r57 
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS9275,3.40.630.30, PF00583, 5845 Molecular Weight 10579.27 Da.
    Residues 94 Isoelectric Point 5.07
    Sequence msnleikqgenkfyigddenhalaeityrfvdnneinidhtgvsdelggqgvgkklvkavveharenhl kiiascsfakhmlekedsyqdvylg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands ACO (ACETYL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2h5m
    1. Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins
    JR Cort, TA Ramelot, D Murray, TB Acton - Journal of structural and , 2008 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch