The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Hypothetical protein PA4359: Northest Structural Genomics Target PaT89. To be Published
    Site NESGC
    PDB Id 2h3j Target Id PaT89
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS9011,PF04023, 7181 Molecular Weight 8251.20 Da.
    Residues 75 Isoelectric Point 11.20
    Sequence msalqpsrsyritgyspaisngyrqrlfsmgllpgaalrvvriaplgdpiqvetrqtslalrrkdlall tlvpld
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2h3j

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch