.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gta

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the putative pyrophosphatase YPJD from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 2gta Target Id SR428
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9095,PF03819 Molecular Weight 12970.02 Da.
    Residues 111 Isoelectric Point 5.13
    Sequence msdktmkdiqaevdryigqfkegyfsplammarlteelgelarevnhrygekpkkateddksmeeeigd vlfvlvclansldisleeahdrvmhkfntrdkdrwtrkeegk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.263
    Matthews' coefficent 3.02 Rfactor 0.225
    Waters 26 Solvent Content 59.27

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 4

    Jmol

     
    Google Scholar output for 2gta
    1. A putative house_cleaning enzyme encoded within an integron array: 1.8 crystal structure defines a new MazG subtype
    A Robinson, AP Guilfoyle, SJ Harrop - Molecular , 2007 - Wiley Online Library
     
    2. Improvement of protein structure comparison using a structural alphabet
    AP Joseph, N Srinivasan, AG de Brevern - Biochimie, 2011 - Elsevier
     
    3. CHARACTERIZATION OF THE N-ACETYL- -D-GLUCOSAMINYL L-MALATE SYNTHASE (BshA) AND DEACETYLASE (BshB) FUNCTIONS FOR BACILLITHIOL
    D Parsonage, GL Newton, RC Holder, BD Wallace - Biochemistry, 2010 - ACS Publications
     
    4. The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis
    F Javid-Majd, D Yang, TR Ioerger - Section D: Biological , 2008 - scripts.iucr.org
     
    5. Structure of a putative NTP pyrophosphohydrolase: YP_001813558. 1 from Exiguobacterium sibiricum 255-15
    GW Han, MA Elsliger, TO Yeates, Q Xu - Section F: Structural , 2010 - scripts.iucr.org
     
    6. Structural and Functional Insights into DR2231 Protein, the MazG-like Nucleoside Triphosphate Pyrophosphohydrolase from Deinococcus radiodurans
    AMD Gonalves, D de Sanctis - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch