The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein (FN1578) from Fusobacterium nucleatum, NESG Target NR1. To be Published
    Site NESGC
    PDB Id 2gsl Target Id NR1
    Molecular Characteristics
    Source Fusobacterium nucleatum
    Alias Ids TPS8981,1.10.1520.10, PF00636 Molecular Weight 15026.76 Da.
    Residues 129 Isoelectric Point 8.81
    Sequence mdnvdfskdirdysglelaflgdaiweleirkyylqfgyniptlnkyvkakvnakyqsliykkiindld eefkvigkraknsniktfprsctvmeykeataleaiigamyllkkeeeikkiinivikge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.60 Rfree 0.292
    Matthews' coefficent 2.61 Rfactor 0.23
    Waters 176 Solvent Content 52.81

    Ligand Information
    Metals MG (MAGNESIUM) x 6


    Google Scholar output for 2gsl

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch