.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gqb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of a conserved unknown protein RPA2825 from Rhodopseudomonas palustris. To be Published
    Site NESGC
    PDB Id 2gqb Target Id RpT4
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS9054,PF12200, 7079 Molecular Weight 13430.67 Da.
    Residues 130 Isoelectric Point 7.97
    Sequence msifgkimsaifgdsaaaspggaqapattgaagtaptapqptaapsidvapildkavkakgeklewrts ivdlmkaldidsslsarkelakelgysgdmndsasmniwlhkqvmsklvanggklppeikh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gqb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch