.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g2x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics reveals EVE as a new ASCH/PUA-related domain. Proteins 75 760-773 2009
    Site NESGC
    PDB Id 2g2x Target Id PpR72
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS9032,3.10.590.10, PF01878 Molecular Weight 16705.19 Da.
    Residues 149 Isoelectric Point 6.41
    Sequence maywlmksepdelsiealarlgearwdgvrnyqarnflramsvgdefffyhsscpqpgiagiaritraa ypdptaldpeshyhdakattdknpwsavdvahvqtfprvlelgrlkqqaglvelplvqkgsrlsvmpvt peqwavivalr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.241
    Matthews' coefficent 2.43 Rfactor 0.193
    Waters 226 Solvent Content 49.44

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 2g2x
    1. Determining the DUF55-domain structure of human thymocyte nuclear protein 1 from crystals partially twinned by tetartohedry
    F Yu, A Song, C Xu, L Sun, J Li, L Tang - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch