.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fvt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of the Rpa2829 protein from Rhodopseudomonas palustris. To be Published
    Site NESGC
    PDB Id 2fvt Target Id RpR43
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS9048,PF04430, 3.40.1230.10, 6964 Molecular Weight 14100.40 Da.
    Residues 127 Isoelectric Point 6.72
    Sequence maqrseiphfprtaaidaygkggfyfadmshqgsllflpdavwgwdvtkpeqidryslqrvfdnanaid tlivgtgadvwiaprqlrealrgvnvvldtmqtgpairtynimigerrrvaaaliavp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fvt
    1. Mutations in NDUFAF3( C3ORF60), Encoding an NDUFAF4 (C6ORF66)-Interacting Complex I Assembly Protein, Cause Fatal Neonatal Mitochondrial
    A Saada, RO Vogel, SJ Hoefs - The American Journal of , 2009 - Elsevier
     
    2. Ann Saada, Rutger O. Vogel, 2, 8 Saskia J. Hoefs, 2 Maril A. van den Brand, 2 Hans J. Wessels, 2 Peter H. Willems, 3 Hanka Venselaar, 4 Avraham Shaag,
    MA Huynen, JAM Smeitink, LP van den Heuvel - The American Journal , 2009 - cmbi.ru.nl
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch