.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ffi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative 2-Pyrone-4,6-Dicarboxylic Acid Hydrolase from Pseudomonas putida, Northeast Structural Genomics Target PpR23. To be Published
    Site NESGC
    PDB Id 2ffi Target Id PpR23
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS9029,PF04909, 3.20.20.140 Molecular Weight 30989.69 Da.
    Residues 280 Isoelectric Point 6.26
    Sequence mrtmpdapalhltaidshahvfsrglnlasqrryapnydaplgdylgqlrahgfshgvlvqpsflgtdn ryllsalqtvpgqlrgvvmlerdveqatlaemarlgvrgvrlnlmgqdmpdltgaqwrpllerigeqgw hvelhrqvadipvlvralqpygldividhfgrpdarrglgqpgfaelltlsgrgkvwvkvsgiyrlqgs peenlafarqalcaleahygaerlmwgsdwphtqhesevsfgsaveqfealgcsaqlrqallldtaral fgfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.61 Rfree 0.287
    Matthews' coefficent 1.89 Rfactor 0.228
    Waters 55 Solvent Content 34.94

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2ffi
    1. Lecture notes on computational structural biology
    Z Wu - 2008 - books.google.com
     
    2. Applications of Structural Bioinformatics for the Structural Genomics Era
    M Novotny - 2007 - uu.diva-portal.org
     
    3. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch