.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ffe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative 2-phospho-(S)-lactate transferase from Methanosarcina mazei, Northeast Structural Genomics Target MaR46. To be Published
    Site OTHER
    Status
    PDB Id 2ffe Target Id no_targetID
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS8967, Molecular Weight
    Residues Isoelectric Point
    Sequence MIIFSGGTGTPKLLDGLKEILPEEELTVVVNTAEDLWVS GNLISPDLDTVLYLFSDQIDRKRWWGIENDTFGTYERMK ELGIEEGLKLGDRDRATHIIRSNIIRDGASLTDSTVKLS SLFGIKANILPMSDDPVSTYIETAEGIMHFQDFWIGKRG EPDVRGVDIRGVSEASISPKVLEAFEKEENILIGPSNPI TSIGPIISLPGMRELLKKKKVVAVSPIIGNAPVSGPAGK LMPACGIEVSSMGVAEYYQDFLDVFVFDERDRADEFAFE
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.279
    Matthews' coefficent 3.34 Rfactor 0.227
    Waters Solvent Content 63.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ffe

    Protein Summary

     

    Ligand Summary

     

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch