.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fdk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB. Nature 439 879-884 2006
    Site NESGC
    PDB Id 2fdk Target Id ER126
    Related PDB Ids 2fdj 2fdi 2fdh 2fdg 2fd8 2fdf 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8827,2.60.120.590, BIG_205 Molecular Weight 24074.24 Da.
    Residues 216 Isoelectric Point 7.73
    Sequence mldlfadaepwqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgw tthrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdkdepd lrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplkagfhpltidcrynl tfrqagkke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.242
    Matthews' coefficent 1.96 Rfactor 0.171
    Waters 192 Solvent Content 37.40

    Ligand Information
    Ligands AKG-SIN (2-OXYGLUTARIC) x 1
    Metals FE2 (FE) x 1

    Jmol

     
    Google Scholar output for 2fdk
    1. Homology modeling and function prediction of hABH1, involving in repair of alkylation damaged DNA
    S Das, AS Vidyarthi - Interdisciplinary Sciences: Computational Life , 2011 - Springer
     
    2. Estate Tax Consequences of Revenue Ruling 2004-64: Silence in Grantor Trusts Is Anything but Golden
    BM Beaman - Drake L. Rev., 2005 - HeinOnline
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch