.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f9c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YDCK from Salmonella cholerae NESG target SCR6. To be Published
    Site NESGC
    PDB Id 2f9c Target Id ScR6
    Related PDB Ids 2pig 
    Molecular Characteristics
    Source Salmonella choleraesuis
    Alias Ids TPS9120,2.160.10.10, 3.90.550.10 Molecular Weight 35920.44 Da.
    Residues 326 Isoelectric Point 5.19
    Sequence mtkyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiydenamaf agteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvreecaiygdarvlnqsei laiqglthehaqilqiydratvnhsrivhqvqlygnatithafiehraevfdfaliegdkdnnvwicdc akvygharviagteedaiptlryssqvaehaliegncvlkhhvlvgghaevrggpillddrvlieghac iqgeilierqveisgraaviafddntihlrgpkvingedritrtplvgsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.323
    Matthews' coefficent 3.00 Rfactor 0.253
    Waters 50 Solvent Content 59.00

    Ligand Information
    Ligands
    Metals CS (CESIUM) x 6

    Jmol

     
    Google Scholar output for 2f9c
    1. A rapid coarse residue-based computational method for X-ray solution scattering characterization of protein folds and multiple conformational states of large protein
    S Yang, S Park, L Makowski, B Roux - Biophysical journal, 2009 - Elsevier
     
    2. Conformation and sequence evidence for two-fold symmetry in left-handed beta-helix fold
    X Shen - Journal of Theoretical Biology, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch