.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f20

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q8A8E9_BACTIN hypothetical protein from Bacteroides thetaiotaomicron. To be Published
    Site NESGC
    PDB Id 2f20 Target Id BtR8
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS8782,PF02586, 3.90.1680.10 Molecular Weight 27127.32 Da.
    Residues 232 Isoelectric Point 5.36
    Sequence mcfhnsmsakaikvaarygrqsdvveiyqsildeqyhvnaftfprypiitssdevqvfnwglipfwvrs eedateirkmtlnaradtifekpsfrepimkkrcivpstgyfewrhegankipyyiyvkdepifsmagi ydrwldkdtgeehetfsiittdtnsltdyidntkhrmpailtqeeeekwlnpslskaeiasllkpfdte kmdayvirndflkkspndptivqra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.251
    Matthews' coefficent 2.44 Rfactor 0.22
    Waters 112 Solvent Content 49.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2f20

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch