.
The Open Protein Structure Annotation Network
PDB Keyword
.

2exn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title (1)H, (13)C, and (15)N Resonance Assignments for the Protein Coded by Gene Locus BB0938 of Bordetella bronchiseptica. J.Biomol.NMR 33 197-197 2005
    Site NESGC
    PDB Id 2exn Target Id BoR11
    Molecular Characteristics
    Source Bordetella bronchiseptica
    Alias Ids TPS8768,6693, PF03476 Molecular Weight 14211.46 Da.
    Residues 128 Isoelectric Point 4.59
    Sequence msttayqpiaecgattqseaaayqkrwlvandagqwlnrdlcprlaevsvelrmgylvlkapgmlrldi pldviedddsvryqmlvgeqtvdvvdegelaaawisnhagvpcrilkvhpdmaevrwps
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2exn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch