.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ewo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of putative agmatine deiminase Q8DW17, Northeast Structural Genomics target SmR6. TO BE PUBLISHED
    Site NESGC
    PDB Id 2ewo Target Id SmR6
    Molecular Characteristics
    Source Streptococcus mutans
    Alias Ids TPS9144,3.75.10.10, PF04371 Molecular Weight 41835.30 Da.
    Residues 369 Isoelectric Point 4.82
    Sequence makriknttpkqdgfrmpgefekqkqiwmlwpwrndnwrlgakpaqkaflevaeaisefepvslcvppl qyenalarvselgshniriiemtnddawirdcgptflvndkgdlravdwefnawgglvdglyfpwdqda lvarkvceiegvdsyktkdfvleggsihvdgegtvlvtemcllhpsrnphltkediedklkdylncvkv lwvkdgidpyetnghiddvacfirpgevaciytddkehpfyqeakaaydflsqqtdakgrplkvhkmcv tkepcylqeaatidyvegsipreegemaiasylnflivnggiilpqygdendqlakqqvqemfpdrkvv gvrteeiaygggnihcitqqqpat
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.90 Rfree 0.269
    Matthews' coefficent 2.44 Rfactor 0.235
    Waters 224 Solvent Content 49.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ewo
    1. The gene cluster for agmatine catabolism of Enterococcus faecalis: study of recombinant putrescine transcarbamylase and agmatine deiminase and a snapshot of
    JL Llcer, LM Polo, S Tavrez, B Alarcn - Journal of , 2007 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch