.
The Open Protein Structure Annotation Network
PDB Keyword
.

2es7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Q8ZP25 from Salmonella typhimurium LT2 NESG target STR70. To be Published
    Site NESGC
    PDB Id 2es7 Target Id StR70
    Related PDB Ids 2gzp 2jzt 
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9173,7178, PF07449, 3.40.30.10 Molecular Weight 15060.29 Da.
    Residues 134 Isoelectric Point 4.69
    Sequence mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiaellrefpqfd wqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlmrsivdtpaaqetvq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.338
    Matthews' coefficent 2.07 Rfactor 0.285
    Waters 560 Solvent Content 40.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2es7
    1. Protein chaperones Q8ZP25_SALTY from Salmonella typhimurium and HYAE_ECOLI from Escherichia coli exhibit thioredoxin-like structures despite lack of canonical
    D Parish, J Benach, G Liu, KK Singarapu - Journal of structural and , 2008 - Springer
     
    2. Development and application of methodology for rapid NMR data collection and protein structure determination
    DM Parish - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch