.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bde

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the cytosolic IMP-GMP specific 5'-nucleotidase (lpg0095) from Legionella pneumophila, Northeast Structural Genomics Target LgR1. To be Published
    Site NESGC
    PDB Id 2bde Target Id LgR1
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS8946,PF05761, 3.40.50.1000 Molecular Weight 53376.43 Da.
    Residues 459 Isoelectric Point 6.48
    Sequence mdthkvfvnriinmrkikligldmdhtlirynsknfeslvydlvkerlaesfhypeeikkfkfnfddai rglvidskngnilklsrygairlsyhgtkqisfsdqkkiyrsiyvdlgdpnymaidtsfsiafcilygq lvdlkdtnpdkmpsyqaiaqdvqycvdkvhsdgtlkniiiknlkkyvirekevveglkhfirygkkifi ltnseysyskllldyalspfldkgehwqglfefvitlankprffydnlrflsvnpengtmtnvhgpivp gvyqggnakkftedlgvggdeilyigdhiygdilrlkkdcnwrtalvveelgeeiasqiralpiekkig eamaikkeleqkyvdlctrsidessqqydqeihdlqlqistvdlqisrllqeqnsfynpkwervfraga eesyfayqvdrfaciymeklsdllehspmtyfranrrllahdidi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.267
    Matthews' coefficent 4.97 Rfactor 0.221
    Waters 71 Solvent Content 75.23

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2bde
    1. Origin of the Correlation of the Rate Constant of Substrate Hydroxylation by Nonheme Iron (IV)oxo Complexes with the Bond_Dissociation Energy of the C H Bond
    R Latifi, M Bagherzadeh - Chemistry-A European , 2009 - Wiley Online Library
     
    2. Crystal Structure of Human Cytosolic 5_-Nucleotidase II
    K Walldn, P Stenmark, T Nyman, S Flodin - Journal of Biological , 2007 - ASBMB
     
    3. ISN1 nucleotidases and HAD superfamily protein fold: in silico sequence and structure analysis
    B Srinivasan, H Balaram - In silico biology, 2007 - IOS Press
     
    4. Structural Basis for the Allosteric Regulation and Substrate Recognition of Human Cytosolic 5'-Nucleotidase II
    K Walldn, P Nordlund - Journal of Molecular Biology, 2011 - Elsevier
     
    5. Structural Basis of Substrate Specificity and Selectivity of Murine Cytosolic 5-Nucleotidase III
    CL Grobosky, JB Lopez, SB Rennie - Journal of Molecular , 2012 - Elsevier
     
    6. Investigation of the structure and function of type III secretion needle and tip proteins
    L Zhang - 2009 - kuscholarworks.ku.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch