The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein Atu5096 from Agrobacterium tumefaciens. To be Published
    Site NESGC
    PDB Id 2aeg Target Id AtR63
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8736,PF02586, 3.90.1680.10 Molecular Weight 29281.10 Da.
    Residues 257 Isoelectric Point 7.78
    Sequence mcnlyrmedkdwvskwaqdaeslinlmpayqmnpdqmgpivrntadgkkqlvharwglpspifvqkkaa earadklkakgkafdinelirmepdrgvtnvrklnlphwtrwfgvehrclvpvtsfaepdpaskqeggn vpnawfardeakslmffagihvpqwksvrkvrdglttddlygflttdpndlvkpihekampvllltree teiwmrapwdeakhlarplpndaliilsrepygssivsksgeseeqgrll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.254
    Matthews' coefficent 2.59 Rfactor 0.217
    Waters 351 Solvent Content 52.00

    Ligand Information


    Google Scholar output for 2aeg

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch