The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the hypothetical protein Q8PZK8 from Methanosarcina mazei at the resolution 2.1A. Northeast Structural Genomics Consortium target MaR9. To be Published
    Site NESGC
    PDB Id 1zq7 Target Id MaR9
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS8971,3.30.1490.150, PF01871, 3.30.700.20 Molecular Weight 21905.92 Da.
    Residues 199 Isoelectric Point 4.89
    Sequence mltetegraavklarktieiflskgksprpdasgvelspvfeeyrgvfvtlteggllrgcighpypdst lkeaildsaisaatrdprfptveqdemknilvevtiltqpekinaspkelpdkveigkhglivkqgycq glllpqvapendmdsidflshtcmkaglspdawvkgaevycfegqifkekepdgevieekf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.11 Rfree 0.248
    Matthews' coefficent 2.34 Rfactor 0.208
    Waters 267 Solvent Content 47.00

    Ligand Information


    Google Scholar output for 1zq7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch