.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zp6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Atu3015, a Putative Cytidylate Kinase from Agrobacterium tumefaciens, Northeast Structural Genomics Target AtR62. To be Published
    Site NESGC
    PDB Id 1zp6 Target Id AtR62
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8735,PF00004, PF07931, 3.40.50.300, 3.40.1140.10 Molecular Weight 19927.49 Da.
    Residues 183 Isoelectric Point 5.78
    Sequence mnmtddlggnilllsghpgsgkstiaealanlpgvpkvhfhsddlwgyikhgridpwlpqshqqnrmim qiaadvagryakegyfvildgvvrpdwlpaftalarplhyivlrttaaeaiercldrggdslsdplvva dlhsqfadlgafehhvlpvsgkdtdqalqsainalqsgrfridas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.20 Rfree 0.322
    Matthews' coefficent 4.60 Rfactor 0.253
    Waters 5 Solvent Content 72.70

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1zp6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch