The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Novel structure of the hypothetical protein Q7WLM8 from Bordetella bronchiseptica. Northeast Structural Genomics Consortium target BoR19. To be Published
    Site NESGC
    PDB Id 1zn6 Target Id BoR19
    Molecular Characteristics
    Source Bordetella bronchiseptica
    Alias Ids TPS8769,PF02586, 3.90.1680.10 Molecular Weight 24767.58 Da.
    Residues 219 Isoelectric Point 6.53
    Sequence mcshyqalkdqermrkyfaahpsaevpadmwprymgafirrplewdsgdeavpereaatgrwgmippgt rpeklaeaskkntsnarsetahqlwtfrnawakaqhciipadaiyepdwrsgkavptrftradgaplgi aglwdryrnaagewidsytmltinadddplfrdyhqagkekrmvvilpdgaygdwltapatdtrdfllp ypadrlvaaavk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.23
    Matthews' coefficent 2.30 Rfactor 0.2033
    Waters 200 Solvent Content 46.00

    Ligand Information
    Ligands SO4 (SULFATE) x 3


    Google Scholar output for 1zn6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch