.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zbo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein BPP1347 from Bordetella parapertussis, Northeast Structural Genomics Target BoR27. To be Published
    Site NESGC
    PDB Id 1zbo Target Id BoR27
    Molecular Characteristics
    Source Bordetella bronchiseptica
    Alias Ids TPS8771,PF02190 Molecular Weight 22228.57 Da.
    Residues 202 Isoelectric Point 5.61
    Sequence maeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgrevlaragtma ridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplevppelarsasalgrliarl qregvpphimpmaapfrlddcgwvadrwaemlslppadkarllllppldrlreidavlaadgha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.297
    Matthews' coefficent 2.44 Rfactor 0.24
    Waters 69 Solvent Content 48.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zbo
    1. Slicing a protease: Structural features of the ATP_dependent Lon proteases gleaned from investigations of isolated domains
    TV Rotanova, I Botos, EE Melnikov, F Rasulova - Protein , 2006 - Wiley Online Library
     
    2. Crystal structure of the N_terminal domain of E. coli Lon protease
    M Li, F Rasulova, EE Melnikov, TV Rotanova - Protein , 2005 - Wiley Online Library
     
    3. Structure of Lmaj006129AAA, a hypothetical protein from Leishmania major
    T Arakaki, I Le Trong, E Phizicky, E Quartley - Section F: Structural , 2006 - scripts.iucr.org
     
    4. High throughput profile-profile based fold recognition for the entire human proteome
    L McGuffin, R Smith, K Bryson, SA Srensen - BMC , 2006 - biomedcentral.com
     
    5. Structure of the catalytic domain of the human mitochondrial Lon protease: proposed relation of oligomer formation and activity
    J Garca_Nafra, G Ondrovi_ov, E Blagova - Protein , 2010 - Wiley Online Library
     
    6. Crystal Structures of Bacillus subtilis Lon Protease
    RE Duman, J Lwe - Journal of molecular biology, 2010 - Elsevier
     
    7. Structure of the N-terminal fragment of Escherichia coli Lon protease
    M Li, A Gustchina, FS Rasulova - Section D: Biological , 2010 - scripts.iucr.org
     
    8. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch