.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zbm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site NESGC
    PDB Id 1zbm Target Id GR62A
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8895,PF02621, 3.40.190.10 Molecular Weight 29479.02 Da.
    Residues 260 Isoelectric Point 4.68
    Sequence kirvahtpdaddafmfyamthgkvdtwleiehviedietlnrkafnaeyevtaisahayallddkyril sagasvgdgygpvvvakseisldgkriavpgryttanlllklavedfepvempfdriiqavldeevdag llihegqityadyglkcvldlwdwwseqvklplplglnairrdlsvevqeeflramresiafaienpde aieyamkysrgldrerakrfammyvndytynmpesvdaalkklyemaeakgli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.265
    Matthews' coefficent 2.55 Rfactor 0.212
    Waters 151 Solvent Content 50.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zbm
    1. A structural classification of substrate-binding proteins
    RPA Berntsson, SHJ Smits, L Schmitt, DJ Slotboom - FEBS letters, 2010 - Elsevier
     
    2. Crystal structure of MqnD (TTHA1568), a menaquinone biosynthetic enzyme from Thermus thermophilus HB8
    R Arai, K Murayama, T Uchikubo-Kamo - Journal of structural , 2009 - Elsevier
     
    3. HMP Binding Protein ThiY and HMP-P Synthase THI5 Are Structural Homologues
    S Bale, KR Rajashankar, K Perry, TP Begley - Biochemistry, 2010 - ACS Publications
     
    4. X-ray structures of two proteins belonging to Pfam DUF178 revealed unexpected structural similarity to the DUF191 Pfam family
    R Tyagi, SK Burley, S Swaminathan - BMC structural biology, 2007 - biomedcentral.com
     
    5. A structural classification of substrate-binding proteins
    PAB Ronnie, SHJ Smits, L Schmitt, DJ Slotboom - FEBS , 2010 - gbb.eldoc.ub.rug.nl
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch