.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z94

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Hypothetical Protein CV1439 from Chromobacterium violaceum. Northeast Structural Genomics Consortium Target CVR12. To be Published
    Site NESGC
    PDB Id 1z94 Target Id CvR12
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS8805,PF10604, 3.30.530.20, PF08327 Molecular Weight 16177.79 Da.
    Residues 147 Isoelectric Point 5.32
    Sequence mpntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafasgqkhafgg rylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipdaippencylgwqqslkqla alvepdmpg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.10 Rfree 0.282
    Matthews' coefficent 2.92 Rfactor 0.245
    Waters 408 Solvent Content 57.93

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1z94
    1. High-throughput computational structure-based characterization of protein families: START domains and implications for structural genomics
    H Lee, Z Li, A Silkov, M Fischer, D Petrey - Journal of structural and , 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch