.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ywz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title To be Published
    Site NESGC
    PDB Id 1ywz Target Id HR41
    Related PDB Ids 2in1 3evx 3e2g 2k07 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8918,6546 Molecular Weight 19457.41 Da.
    Residues 167 Isoelectric Point 6.91
    Sequence madeatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkegtrwfgkcw yihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfkplwarnvpkfglahlma lglgpwlaveipdliqkgviqhkekcnq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ywz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch