.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yww

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of Pseudomonas aeruginosa protein PA4738. To be Published
    Site NESGC
    PDB Id 1yww Target Id PaP2
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS9001,1.10.1470.10, 6517, PF05532 Molecular Weight 7611.08 Da.
    Residues 65 Isoelectric Point 5.30
    Sequence mnsdvikgkwkqltgkikerwgdltdddlqaadghaeylvgklqerygwskeraeqevrdfsdrl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yww
    1. Structurefunction analysis of pneumococcal DprA protein reveals that dimerization is crucial for loading RecA recombinase onto DNA during transformation
    S Quevillon-Cheruel, N Campo - Proceedings of the , 2012 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch