.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xn5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Bacillus halodurans Protein BH1534: The Northeast Structural Genomics Consortium Target BhR29. To be Published
    Site NESGC
    PDB Id 1xn5 Target Id BhR29
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS31715,PF10604, 6369, 3.30.530.20, PF08327 Molecular Weight 15917.14 Da.
    Residues 138 Isoelectric Point 5.48
    Sequence mtrlpdikkevrfnapiekvweavstseglafwfmendlkaetghhfhlqspfgpspcqvtdverpikl sftwdtdgwsvtfhlkeeengtiftivhsgwkqgdtkvekagaesavvhermdrgwhdlvnerlrqive
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xn5
    1. NMR data collection and analysis protocol for high-throughput protein structure determination
    G Liu, Y Shen, HS Atreya, D Parish - Proceedings of the , 2005 - National Acad Sciences
     
    2. Structural insight into the self-sacrifice mechanism of enediyne resistance
    S Singh, MH Hager, C Zhang, BR Griffith, MS Lee - 2006 - ACS Publications
     
    3. High-throughput computational structure-based characterization of protein families: START domains and implications for structural genomics
    H Lee, Z Li, A Silkov, M Fischer, D Petrey - Journal of structural and , 2010 - Springer
     
    4. Solution structure and function of YndB, an AHSA1 protein from Bacillus subtilis
    JL Stark, KA Mercier, GA Mueller - Proteins: Structure, , 2010 - Wiley Online Library
     
    5. 1 H, 13 C, and 15 N NMR assignments for the Bacillus subtilis yndB START domain
    KA Mercier, GA Mueller, TB Acton, R Xiao - Biomolecular NMR , 2009 - Springer
     
    6. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch