.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xeq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Studies of theN-terminal domain of Non-structural protein 1 of influenza virus B. To be Published
    Site NESGC
    PDB Id 1xeq Target Id OR2
    Molecular Characteristics
    Source Other
    Alias Ids TPS8995,PF02942 Molecular Weight 11863.02 Da.
    Residues 103 Isoelectric Point 7.87
    Sequence madnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepen krmsleerkaigvkmmkvllfmdpsagiegfepy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.25567
    Matthews' coefficent 3.10 Rfactor 0.21335
    Waters 234 Solvent Content 60.00

    Ligand Information
    Ligands
    Metals BR (BROMIDE) x 19

    Jmol

     
    Google Scholar output for 1xeq
    1. Conserved surface features form the double-stranded RNA binding site of non-structural protein 1 (NS1) from influenza A and B viruses
    C Yin, JA Khan, GVT Swapna, A Ertekin - Journal of Biological , 2007 - ASBMB
     
    2. Crystal Structure of Human ISG15 Protein in Complex with Influenza B Virus NS1B
    L Li, D Wang, Y Jiang, J Sun, S Zhang, Y Chen - Journal of Biological , 2011 - ASBMB
     
    3. Structural Disorder in Proteins from Influenza Virus
    GKM Goh, B Xue, AK Dunker, VN Uversky - Flexible Viruses, 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch