.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x9a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A novel member of the YchN-like fold: solution structure of the hypothetical protein Tm0979 from Thermotoga maritima. Protein Sci. 14 216-223 2005
    Site NESGC
    PDB Id 1x9a Target Id VT98
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS9227,PF04077, 3.40.1260.10 Molecular Weight 9875.84 Da.
    Residues 87 Isoelectric Point 4.71
    Sequence malvlvkygtdhpveklkirsakaedkivliqngvfwaleeletpakvyaikddflargyseedskvpl itysefidllegeekfig
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1x9a
    1. Sonication of proteins causes formation of aggregates that resemble amyloid
    PB Stathopulos, GA Scholz, YM Hwang - Protein , 2004 - Wiley Online Library
     
    2. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
     
    3. Structural and molecular genetic insight into a widespread sulfur oxidation pathway
    C Dahl, A Schulte, Y Stockdreher, C Hong - Journal of molecular , 2008 - Elsevier
     
    4. Folding and Association of Thermophilic Dimeric and Trimeric DsrEFH Proteins: Tm0979 and Mth1491
    C Galvagnion, MTJ Smith, A Broom, KA Vassall - Biochemistry, 2009 - ACS Publications
     
    5. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     
    6. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    7. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch