.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tvi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structure of Thermotoga maritima protein TM1509 reveals a Zn-metalloprotease-like tertiary structure. J.STRUCT.FUNCT.GENOM. 6 51-62 2005
    Site NESGC
    PDB Id 1tvi Target Id VT1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS9223,3.40.390.30, 6256, PF02130 Molecular Weight 17548.96 Da.
    Residues 150 Isoelectric Point 4.69
    Sequence mirilgegkgskllenlkekleeivkkeigdvhvnvilvsedeikelnqqfrgqdrptdvltfplmeed vygeiyvcpliveenarefnntfekellevvihgilhlagydhefedknskemfekqkkyveevwgewr snpsedsdpgkr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tvi
    1. Microbial biochemistry, physiology, and biotechnology of hyperthermophilic Thermotoga species
    SB Conners, EF Mongodin, MR Johnson - FEMS microbiology , 2006 - Wiley Online Library
     
    2. NMR solution structure of Thermotoga maritima protein TM1509 reveals a Zn-metalloprotease-like tertiary structure
    CH Penhoat, Z Li, HS Atreya, S Kim, A Yee - Journal of structural and , 2005 - Springer
     
    3. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    4. Carbohydrate utilization pathway analysis in the hyperthermophile Thermotoga maritima
    SB Conners - 2006 - repository.lib.ncsu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch