.
The Open Protein Structure Annotation Network
PDB Keyword
.

1te4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title MTH187 from Methanobacterium thermoautotrophicum has three HEAT-like Repeats. J.Biomol.Nmr 35 149-154 2006
    Site NESGC
    PDB Id 1te4 Target Id TT740
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9210,1.25.10.10, PF03130, PF02985, 5629 Molecular Weight 12394.22 Da.
    Residues 111 Isoelectric Point 4.93
    Sequence madenkwvrrdvstalsrmgdeafeplleslsnedwrirgaaawiignfqderavepliklleddsgfv rsgaarsleqiggervraameklaetgtgfarkvavnyleth
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1te4
    1. Insights into the domain and repeat architecture of target of rapamycin
    BA Knutson - Journal of structural biology, 2010 - Elsevier
     
    2. Design, Production and Molecular Structure of a New Family of Artificial Alpha-helicoidal Repeat Proteins (_Rep) Based on Thermostable HEAT-like Repeats
    A Urvoas, A Guellouz, M Valerio-Lepiniec - Journal of molecular , 2010 - Elsevier
     
    3. MTH187 from Methanobacterium thermoautotrophicum has three HEAT-like repeats
    O Julien, I Gignac, A Hutton, A Yee - Journal of biomolecular , 2006 - Springer
     
    4. Exploring the Role of CH. Interactions on the Structural Stability of Single Chain All-Alpha Proteins
    V Shanthi, K Ramanathan - Applied biochemistry and , 2010 - Springer
     
    5. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    6. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch